DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab9Fa

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_727471.1 Gene:Rab9Fa / 326230 FlyBaseID:FBgn0052671 Length:197 Species:Drosophila melanogaster


Alignment Length:168 Identity:49/168 - (29%)
Similarity:89/168 - (52%) Gaps:13/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PCKVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVD-----FELENFSILGHNYSLEMWDTAGQ 123
            |.|:|.:||..||||.::.||..::|.:.:::|:|:|     .|..::.:   ...|::|||:..
  Fly     7 PFKIIILGDSGVGKTCLLMRFSDNQFTTRHRSTVGLDRRECSVEFADWRM---GRMLQVWDTSDD 68

  Fly   124 ERFRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEF 188
            |||:.:.....|:|..|::.||::...|.::...|:.. :......:..|.|||.|:|..:..: 
  Fly    69 ERFKLLKATQCRSAHGILLVYDITSSKSFQNIDGWMKE-IRRLCPDKVTVLLVGNKSDDPNHRQ- 131

  Fly   189 VRMERLAGLAAAELQAE-YWSVSARSGFKVTELFQRIA 225
            |.|.:  |...|..|:. :..|||:||..|.::|..:|
  Fly   132 VSMAQ--GFNYAHRQSICFEEVSAKSGRNVYDIFSSLA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 48/166 (29%)
RAB 66..225 CDD:197555 47/164 (29%)
Rab9FaNP_727471.1 RAB 8..171 CDD:197555 48/167 (29%)
Rab 8..167 CDD:206640 47/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.