DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab39

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001245568.1 Gene:Rab39 / 31684 FlyBaseID:FBgn0029959 Length:218 Species:Drosophila melanogaster


Alignment Length:194 Identity:65/194 - (33%)
Similarity:98/194 - (50%) Gaps:29/194 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNYKATIGVDF-----ELENFSILGHNYSLEMWDTAGQER 125
            ::|.:||.:|||::::..|...||......|:||||     |:::    |....|::||||||||
  Fly    11 RLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKD----GTQIKLQLWDTAGQER 71

  Fly   126 FRCIAGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLL------- 183
            ||.|..:||||:..:::.||:|...|.|....|:..|..:....||:..|||.|.||:       
  Fly    72 FRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHRE 136

  Fly   184 -SKEEFVRMERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQE 246
             :.||..:..:..||...|       .|||||..|.|.|:.:.     :.|...|||.:.|.::
  Fly   137 VTTEEAQKFAKQHGLHFVE-------TSARSGANVEEAFRMVT-----QEVYARIRSGEYKAED 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 60/176 (34%)
RAB 66..225 CDD:197555 60/171 (35%)
Rab39NP_001245568.1 Rab39 8..218 CDD:133311 65/194 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.