DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and Rab6b

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006511799.1 Gene:Rab6b / 270192 MGIID:107283 Length:234 Species:Mus musculus


Alignment Length:270 Identity:82/270 - (30%)
Similarity:120/270 - (44%) Gaps:51/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HDPRTHLRHLPPAYSAAQTPLSKERDFGAQVRYYLEA------PRKPKFRPCKVIFVGDCSVGKT 78
            |.|..|             |...|...||  |..|:|      |....|............||||
Mouse     4 HHPWVH-------------PHPAEASLGA--RDALDASAMAATPGSEAFSSAPCSSTSGAKVGKT 53

  Fly    79 AIVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIAGAYYRNASVIVVT 143
            :::.||.||.|.:.|:||||:||..:...:......|::||||||||||.:..:|.|:::|.||.
Mouse    54 SLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVV 118

  Fly   144 YDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLAGLAAAELQAEYWS 208
            ||::..:|.:...||::.......|. .::.|||.|.||..|.:....|  ....|.||...:..
Mouse   119 YDITNLNSFQQTSKWIDDVRTERGSD-VIIMLVGNKTDLADKRQITIEE--GEQRAKELSVMFIE 180

  Fly   209 VSARSGFKVTELFQRIA-ALAFEEAVMQEIR----SIK-NKPQEQATQASVKSQTFDLRNFFGSR 267
            .||::|:.|.:||:|:| ||...|.|.::.:    .|| :||||...                  
Mouse   181 TSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPA------------------ 227

  Fly   268 LSQQKSGCTC 277
               .:.||:|
Mouse   228 ---SEGGCSC 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 59/164 (36%)
RAB 66..225 CDD:197555 56/158 (35%)
Rab6bXP_006511799.1 Rab6 50..200 CDD:206654 57/152 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.