DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RabX5 and rab34b

DIOPT Version :9

Sequence 1:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_001346073.4 Gene:rab34b / 100007678 ZFINID:ZDB-GENE-091118-61 Length:254 Species:Danio rerio


Alignment Length:261 Identity:107/261 - (40%)
Similarity:145/261 - (55%) Gaps:21/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LRHLPPAYS---AAQTPLSKERD--------FGAQVRYYLEAPRKPKFRPCKVIFVGDCSVGKTA 79
            :..|||...   ..:.||...||        |...||...:. :|......|||.|||..||||.
Zfish     2 MNSLPPVKGDRIICELPLYFTRDAAVHTKDGFNITVREACQG-QKTGLNVAKVIVVGDVGVGKTC 65

  Fly    80 IVNRFCYDKFQSNYKATIGVDFELENFSILGHNYSLEMWDTAGQERFRCIAGAYYRNASVIVVTY 144
            ::||||.|.|...||||||||||:|.|.:||..:||::|||||||||||||..|||.|..|:|.:
Zfish    66 LINRFCKDSFDRTYKATIGVDFEMERFEVLGVPFSLQLWDTAGQERFRCIASTYYRGAQAIIVVF 130

  Fly   145 DMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRMERLAGLAAAELQAEYWSV 209
            |:|..:||:.|::||..|:..|.....|:||||||.||...:...:||:.|...:.|::||||:|
Zfish   131 DLSNYESLDHAREWLEDAMRDNDPSSVLLFLVGTKKDLSHPDLLAQMEQEAIRLSEEIRAEYWAV 195

  Fly   210 SARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQEQATQASVKSQTFDLRNFFGSRLSQQKSG 274
            ||.||..|.:.|.|:|:|.||..|:.|:.  ||..:.......:.       |...:...:::|.
Zfish   196 SALSGASVRDFFLRVASLTFEATVLSELE--KNNSRRAGDIVKIS-------NNCDNNFKKRQSS 251

  Fly   275 C 275
            |
Zfish   252 C 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 87/163 (53%)
RAB 66..225 CDD:197555 85/158 (54%)
rab34bXP_001346073.4 P-loop_NTPase 63..218 CDD:304359 81/154 (53%)
PTZ00099 73..252 CDD:185444 81/187 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 181 1.000 Domainoid score I3418
eggNOG 1 0.900 - - E1_KOG0094
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3733
OMA 1 1.010 - - QHG48903
OrthoDB 1 1.010 - - D1048146at2759
OrthoFinder 1 1.000 - - FOG0003705
OrthoInspector 1 1.000 - - otm24699
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2570
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.