DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and RPL25

DIOPT Version :10

Sequence 1:NP_523886.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_014514.1 Gene:RPL25 / 853993 SGDID:S000005487 Length:142 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:80/150 - (53%)
Similarity:104/150 - (69%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 AKGTAKAKAVALLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRM 192
            ||.||..|||            :||..|.:|.|:||:..||.|.||||.|:|||..|:||..||:
Yeast     5 AKATAAKKAV------------VKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRL 57

  Fly   193 DAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQKKA 257
            |:|.:|:.|:|:|.||||:||.|.|||...::|||..::.||::||::.|.|||.|:||:|.|||
Yeast    58 DSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKA 122

  Fly   258 YVRLARDYDALDIANKIGII 277
            ||||..|||||||||:||.|
Yeast   123 YVRLTADYDALDIANRIGYI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_523886.1 PTZ00191 132..277 CDD:185507 76/144 (53%)
RPL25NP_014514.1 PTZ00191 20..142 CDD:185507 70/121 (58%)

Return to query results.
Submit another query.