DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and RPL25

DIOPT Version :9

Sequence 1:NP_001356972.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_014514.1 Gene:RPL25 / 853993 SGDID:S000005487 Length:142 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:80/150 - (53%)
Similarity:104/150 - (69%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 AKGTAKAKAVALLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRM 192
            ||.||..|||            :||..|.:|.|:||:..||.|.||||.|:|||..|:||..||:
Yeast     5 AKATAAKKAV------------VKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRL 57

  Fly   193 DAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQKKA 257
            |:|.:|:.|:|:|.||||:||.|.|||...::|||..::.||::||::.|.|||.|:||:|.|||
Yeast    58 DSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKA 122

  Fly   258 YVRLARDYDALDIANKIGII 277
            ||||..|||||||||:||.|
Yeast   123 YVRLTADYDALDIANRIGYI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_001356972.1 PTZ00191 132..277 CDD:185507 76/144 (53%)
RPL25NP_014514.1 PTZ00191 20..142 CDD:185507 70/121 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343488
Domainoid 1 1.000 74 1.000 Domainoid score I2167
eggNOG 1 0.900 - - E1_COG0089
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110453
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000947
OrthoInspector 1 1.000 - - oto99764
orthoMCL 1 0.900 - - OOG6_100365
Panther 1 1.100 - - LDO PTHR11620
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1121
SonicParanoid 1 1.000 - - X773
TreeFam 1 0.960 - -
1312.730

Return to query results.
Submit another query.