DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and AT4G39880

DIOPT Version :10

Sequence 1:NP_523886.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_195698.1 Gene:AT4G39880 / 830147 AraportID:AT4G39880 Length:178 Species:Arabidopsis thaliana


Alignment Length:112 Identity:28/112 - (25%)
Similarity:36/112 - (32%) Gaps:48/112 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VHFRR-PTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKN 228
            |||.. |..|.:|..               ..||.::.|.|..:..|||                
plant    10 VHFANLPIKLLMPAK---------------LTNIHEFALKTIPSASKIE---------------- 43

  Fly   229 HVRAAVRKLYDIKVAKVNVLIRPDGQ--------------KKAYVRL 261
             ::..:..||...|.|||.| ..||:              |||||.|
plant    44 -IKRVLESLYGFDVEKVNTL-NMDGKKKKRGGLLIAKADYKKAYVTL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_523886.1 PTZ00191 132..277 CDD:185507 28/112 (25%)
AT4G39880NP_195698.1 Ribosomal_L23 <37..89 CDD:459743 18/70 (26%)

Return to query results.
Submit another query.