DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and RPL23AB

DIOPT Version :9

Sequence 1:NP_001356972.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001078293.1 Gene:RPL23AB / 824694 AraportID:AT3G55280 Length:154 Species:Arabidopsis thaliana


Alignment Length:204 Identity:99/204 - (48%)
Similarity:115/204 - (56%) Gaps:52/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PAAVKTTAAAKAKSKDAKKKVLAGKKPQSVLAKLSAKARAAAKAKKGVKPVTKPAKGTAKAKAVA 138
            ||.|..|..|..|                      |||..||||.|..:.|.||||         
plant     3 PAKVDVTKKADPK----------------------AKALKAAKAVKSGQIVKKPAK--------- 36

  Fly   139 LLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYPLT 203
                                 ||||.|.|.||.||.:||.||||:.|...||::|.|.|:|||||
plant    37 ---------------------KIRTKVTFHRPKTLTVPRKPKYPKISATPRNKLDHYQILKYPLT 80

  Fly   204 TEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQKKAYVRLARDYDAL 268
            ||:|||||||||||||:..:||:|..::.||:|:|||:..|||.||||||.|||||||..|||||
plant    81 TESAMKKIEDNNTLVFIVDIRADKKKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDAL 145

  Fly   269 DIANKIGII 277
            |:|||||||
plant   146 DVANKIGII 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_001356972.1 PTZ00191 132..277 CDD:185507 78/144 (54%)
RPL23ABNP_001078293.1 PTZ00191 31..154 CDD:185507 83/152 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2629
eggNOG 1 0.900 - - E1_COG0089
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110453
Inparanoid 1 1.050 175 1.000 Inparanoid score I1501
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1436090at2759
OrthoFinder 1 1.000 - - FOG0000947
OrthoInspector 1 1.000 - - otm2411
orthoMCL 1 0.900 - - OOG6_100365
Panther 1 1.100 - - LDO PTHR11620
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X773
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.