DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and RPL23AA

DIOPT Version :9

Sequence 1:NP_001356972.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001154565.1 Gene:RPL23AA / 818531 AraportID:AT2G39460 Length:154 Species:Arabidopsis thaliana


Alignment Length:152 Identity:90/152 - (59%)
Similarity:108/152 - (71%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PAKGTAKAKAVALLNAKKVQKKIIKG-AFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRN 190
            |||.....||.....|.|..|.:..| ||..:.:||||.|.|.||.||..||:.|||:.|...||
plant     3 PAKVDTTKKADPKAKALKAAKAVKSGQAFKKKDKKIRTKVTFHRPKTLTKPRTGKYPKISATPRN 67

  Fly   191 RMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQK 255
            ::|.|.|:|||||||:|||||||||||||:..:||:|..::.||:|:|||:..|||.||||||.|
plant    68 KLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKKKIKDAVKKMYDIQTKKVNTLIRPDGTK 132

  Fly   256 KAYVRLARDYDALDIANKIGII 277
            ||||||..||||||:|||||||
plant   133 KAYVRLTPDYDALDVANKIGII 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_001356972.1 PTZ00191 132..277 CDD:185507 85/145 (59%)
RPL23AANP_001154565.1 PTZ00191 38..154 CDD:185507 76/115 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2629
eggNOG 1 0.900 - - E1_COG0089
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110453
Inparanoid 1 1.050 175 1.000 Inparanoid score I1501
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1436090at2759
OrthoFinder 1 1.000 - - FOG0000947
OrthoInspector 1 1.000 - - otm2411
orthoMCL 1 0.900 - - OOG6_100365
Panther 1 1.100 - - LDO PTHR11620
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X773
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.