DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and Rpl23al7

DIOPT Version :10

Sequence 1:NP_523886.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_038934120.1 Gene:Rpl23al7 / 690335 RGDID:1597353 Length:148 Species:Rattus norvegicus


Alignment Length:132 Identity:71/132 - (53%)
Similarity:91/132 - (68%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AKKGVKPVTKPAKGTAKAKAVALLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKY 181
            |.|..|....|.|...|.||:      |.:|.::||. .:..:||||:..||||.||:|.|.|||
  Rat     2 APKAKKEAPAPPKAEVKGKAL------KAKKAVLKGV-DSHKKKIRTSPTFRRPKTLRLRRQPKY 59

  Fly   182 PRKSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVN 246
            |||..|.||::|.|.|||:|||||:|||||||||||||:..::|||:.::.|::|||||.|||||
  Rat    60 PRKGAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFVVDVKANKHQIKQALKKLYDIDVAKVN 124

  Fly   247 VL 248
            .|
  Rat   125 TL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_523886.1 PTZ00191 132..277 CDD:185507 66/117 (56%)
Rpl23al7XP_038934120.1 PTZ00191 1..132 CDD:185507 71/132 (54%)

Return to query results.
Submit another query.