DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and LOC680441

DIOPT Version :9

Sequence 1:NP_001356972.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_038964968.1 Gene:LOC680441 / 680441 RGDID:1591759 Length:154 Species:Rattus norvegicus


Alignment Length:161 Identity:93/161 - (57%)
Similarity:113/161 - (70%) Gaps:8/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AKKGVKPVTKPAKGTAKAKAVALLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKY 181
            |.|..|....|.|...||:|:      |.:|.::||.. :..:||||:..||||.||:|.|.|||
  Rat     2 APKTKKEAPAPPKAETKARAL------KAKKAVLKGVH-SHKKKIRTSPTFRRPKTLQLRRQPKY 59

  Fly   182 PRKSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVN 246
            |.||.|.||::|...|||:|||||:||||||| ||||.:..::|||:.::.||.|||||.|||||
  Rat    60 PGKSAPRRNKLDHSAIIKFPLTTESAMKKIED-NTLVLIVDIKANKHQIKQAVEKLYDIDVAKVN 123

  Fly   247 VLIRPDGQKKAYVRLARDYDALDIANKIGII 277
            .|||||.:||.|||||.||||||.|||||||
  Rat   124 TLIRPDREKKVYVRLAPDYDALDAANKIGII 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_001356972.1 PTZ00191 132..277 CDD:185507 86/144 (60%)
LOC680441XP_038964968.1 PTZ00191 1..154 CDD:185507 91/159 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7127
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3713
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000947
OrthoInspector 1 1.000 - - otm45640
orthoMCL 1 0.900 - - OOG6_100365
Panther 1 1.100 - - O PTHR11620
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X773
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.