DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and RGD1565170

DIOPT Version :9

Sequence 1:NP_001356972.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017455454.1 Gene:RGD1565170 / 498523 RGDID:1565170 Length:156 Species:Rattus norvegicus


Alignment Length:161 Identity:98/161 - (60%)
Similarity:119/161 - (73%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AKKGVKPVTKPAKGTAKAKAVALLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKY 181
            |.|..|....|.|..|||||:      |.:|.::||....:.:||||:..||||.||:|.|.|||
  Rat     2 APKAKKEAPAPPKAEAKAKAL------KAKKAVLKGIHSHKKKKIRTSPTFRRPETLRLQRQPKY 60

  Fly   182 PRKSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVN 246
            ||||.|.||::|.|.|||:|||||:||||||||:||||...::|||:.|:.||:|||||.|||||
  Rat    61 PRKSAPRRNKLDRYAIIKFPLTTESAMKKIEDNHTLVFTVDVKANKHQVKQAVKKLYDIDVAKVN 125

  Fly   247 VLIRPDGQKKAYVRLARDYDALDIANKIGII 277
            .||||||:|||||..|.||:|||:|||||||
  Rat   126 TLIRPDGEKKAYVHSAPDYEALDVANKIGII 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_001356972.1 PTZ00191 132..277 CDD:185507 91/144 (63%)
RGD1565170XP_017455454.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1436090at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.