DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and Rpl23a

DIOPT Version :9

Sequence 1:NP_001356972.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001101753.1 Gene:Rpl23a / 360572 RGDID:1304897 Length:156 Species:Rattus norvegicus


Alignment Length:161 Identity:101/161 - (62%)
Similarity:122/161 - (75%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AKKGVKPVTKPAKGTAKAKAVALLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKY 181
            |.|..|....|.|..|||||:      |.:|.::||....:.:||||:..||||.||:|.|.|||
  Rat     2 APKAKKEAPAPPKAEAKAKAL------KAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKY 60

  Fly   182 PRKSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVN 246
            ||||.|.||::|.|.|||:|||||:|||||||||||||:..::|||:.::.||:|||||.|||||
  Rat    61 PRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVN 125

  Fly   247 VLIRPDGQKKAYVRLARDYDALDIANKIGII 277
            .||||||:||||||||.||||||:|||||||
  Rat   126 TLIRPDGEKKAYVRLAPDYDALDVANKIGII 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_001356972.1 PTZ00191 132..277 CDD:185507 94/144 (65%)
Rpl23aNP_001101753.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67 33/70 (47%)
PTZ00191 36..156 CDD:185507 85/119 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7127
eggNOG 1 0.900 - - E1_COG0089
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110453
Inparanoid 1 1.050 199 1.000 Inparanoid score I3713
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1436090at2759
OrthoFinder 1 1.000 - - FOG0000947
OrthoInspector 1 1.000 - - otm45640
orthoMCL 1 0.900 - - OOG6_100365
Panther 1 1.100 - - LDO PTHR11620
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X773
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.