DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and Rpl23al2

DIOPT Version :10

Sequence 1:NP_523886.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017455901.2 Gene:Rpl23al2 / 290916 RGDID:1565806 Length:151 Species:Rattus norvegicus


Alignment Length:156 Identity:82/156 - (52%)
Similarity:107/156 - (68%) Gaps:11/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KPVTKPAKGTAKAKAVALLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSV 186
            |.|..|.|..||.||:      |.:|:::||..|.:.:||..:..|..|.||:|.|.||||||||
  Rat     7 KEVPAPPKAEAKVKAL------KAKKELLKGVHGHKKKKIHMSHTFWWPKTLQLWRQPKYPRKSV 65

  Fly   187 PTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRP 251
            |   :::.|.:|::|||||:||.||| ||.|||:..::|||..|:..::|||||.|||||.||||
  Rat    66 P---KLNHYALIRFPLTTESAMMKIE-NNMLVFIVDVKANKQQVKQGMKKLYDIDVAKVNTLIRP 126

  Fly   252 DGQKKAYVRLARDYDALDIANKIGII 277
            ||: ||.|.|..||:|||:||||.||
  Rat   127 DGE-KANVHLVLDYNALDVANKIVII 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_523886.1 PTZ00191 132..277 CDD:185507 76/144 (53%)
Rpl23al2XP_017455901.2 PTZ00191 40..151 CDD:185507 66/115 (57%)

Return to query results.
Submit another query.