DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and rpl2502

DIOPT Version :9

Sequence 1:NP_001356972.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_596104.1 Gene:rpl2502 / 2540851 PomBaseID:SPBC4F6.04 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:136 Identity:77/136 - (56%)
Similarity:100/136 - (73%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 AKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYPLTTEA 206
            ||..||.:.||.....|||:||:..||||.||:|.|.|||.|||||..:|:|.|.||..|:.:|:
pombe     6 AKGAQKTVQKGIHNKVARKVRTSTTFRRPKTLELARKPKYARKSVPHASRLDEYKIIVNPINSES 70

  Fly   207 AMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQKKAYVRLARDYDALDIA 271
            |||||||:|||||..||:|||..::.||:|||.:...|:|.||||:|.|||:|:|:.|.||||:|
pombe    71 AMKKIEDDNTLVFHVHLKANKFTIKNAVKKLYSVDAVKINTLIRPNGTKKAFVKLSADADALDVA 135

  Fly   272 NKIGII 277
            |:||.:
pombe   136 NRIGFL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_001356972.1 PTZ00191 132..277 CDD:185507 77/134 (57%)
rpl2502NP_596104.1 PTZ00191 3..141 CDD:185507 77/134 (57%)
Ribosomal_L23eN 16..52 CDD:281872 21/35 (60%)
Ribosomal_L23 59..139 CDD:294232 46/79 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I2381
eggNOG 1 0.900 - - E1_COG0089
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110453
Inparanoid 1 1.050 155 1.000 Inparanoid score I1276
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000947
OrthoInspector 1 1.000 - - otm47290
orthoMCL 1 0.900 - - OOG6_100365
Panther 1 1.100 - - LDO PTHR11620
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1121
SonicParanoid 1 1.000 - - X773
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.