DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and rpl-25.1

DIOPT Version :9

Sequence 1:NP_001356972.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_508808.1 Gene:rpl-25.1 / 180748 WormBaseID:WBGene00004438 Length:147 Species:Caenorhabditis elegans


Alignment Length:151 Identity:87/151 - (57%)
Similarity:111/151 - (73%) Gaps:9/151 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PAKGTAKAKAVALLNAKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNR 191
            ||| ||||     |:||   ||::||...|..|::||:||||||.|||..|..::||||.|..::
 Worm     6 PAK-TAKA-----LDAK---KKVVKGKRTTHRRQVRTSVHFRRPVTLKTARQARFPRKSAPKTSK 61

  Fly   192 MDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQKK 256
            ||.:.||::|||||:||||||::|||||:....|||..::.||.|||:::..|||.||.|..|||
 Worm    62 MDHFRIIQHPLTTESAMKKIEEHNTLVFIVSNDANKYQIKDAVHKLYNVQALKVNTLITPLQQKK 126

  Fly   257 AYVRLARDYDALDIANKIGII 277
            |||||..||||||:|||||:|
 Worm   127 AYVRLTADYDALDVANKIGVI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_001356972.1 PTZ00191 132..277 CDD:185507 82/144 (57%)
rpl-25.1NP_508808.1 PTZ00191 2..147 CDD:185507 86/149 (58%)
Ribosomal_L23eN 22..58 CDD:281872 19/35 (54%)
PRK14548 65..147 CDD:237750 51/81 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160074
Domainoid 1 1.000 76 1.000 Domainoid score I5815
eggNOG 1 0.900 - - E1_COG0089
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H110453
Inparanoid 1 1.050 165 1.000 Inparanoid score I2808
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29099
OrthoDB 1 1.010 - - D1436090at2759
OrthoFinder 1 1.000 - - FOG0000947
OrthoInspector 1 1.000 - - otm14261
orthoMCL 1 0.900 - - OOG6_100365
Panther 1 1.100 - - LDO PTHR11620
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1121
SonicParanoid 1 1.000 - - X773
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.