DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL23A and rpl-25.2

DIOPT Version :9

Sequence 1:NP_001356972.1 Gene:RpL23A / 38208 FlyBaseID:FBgn0026372 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001369950.1 Gene:rpl-25.2 / 172617 WormBaseID:WBGene00004439 Length:146 Species:Caenorhabditis elegans


Alignment Length:136 Identity:76/136 - (55%)
Similarity:103/136 - (75%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 AKKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYPLTTEA 206
            |.:.:|.::||:.....:.:||:||||||.||...|:|:|.|||.|.|:::|::.:||.|.|||:
 Worm    11 AIQAKKAVVKGSKTNVRKNVRTSVHFRRPKTLVTARAPRYARKSAPARDKLDSFAVIKAPHTTES 75

  Fly   207 AMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQKKAYVRLARDYDALDIA 271
            :||||||:|||||:...:|||:|::.||..||::|..|||.||.|..|||||||||.||||||:|
 Worm    76 SMKKIEDHNTLVFIVDEKANKHHIKRAVHALYNVKAVKVNTLITPLQQKKAYVRLASDYDALDVA 140

  Fly   272 NKIGII 277
            ||||.|
 Worm   141 NKIGFI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL23ANP_001356972.1 PTZ00191 132..277 CDD:185507 75/134 (56%)
rpl-25.2NP_001369950.1 PTZ00191 1..146 CDD:185507 75/134 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160075
Domainoid 1 1.000 76 1.000 Domainoid score I5815
eggNOG 1 0.900 - - E1_COG0089
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H110453
Inparanoid 1 1.050 165 1.000 Inparanoid score I2808
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29099
OrthoDB 1 1.010 - - D1436090at2759
OrthoFinder 1 1.000 - - FOG0000947
OrthoInspector 1 1.000 - - otm14261
orthoMCL 1 0.900 - - OOG6_100365
Panther 1 1.100 - - O PTHR11620
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1121
SonicParanoid 1 1.000 - - X773
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.