DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7974 and SPAC1D4.01

DIOPT Version :9

Sequence 1:NP_001261273.1 Gene:CG7974 / 38207 FlyBaseID:FBgn0035254 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001342820.1 Gene:SPAC1D4.01 / 5802861 PomBaseID:SPAC1D4.01 Length:254 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:55/289 - (19%)
Similarity:119/289 - (41%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KKAGRKNLRQRK--NSDEEEKEEQLTLDEIKERQRL---RQRPNGVSLVGL----ALGKKIAPEE 73
            ||...::.|:||  .:::|...|:|..::|:.||.|   ::|....|::|:    .|.::...|:
pombe     7 KKKSNRSFRRRKVFGNEKEFDLEELDDNDIRLRQALEATKRRKIRNSIIGINAEKLLNQETKKEK 71

  Fly    74 EL-AIKDPFNVKTGGLVNMKQLKSGKMKEADDAYDVGIGTQFSAETNKRDEDEEMMKYIEQELQK 137
            :| ...:|............:|...::...:|        :|:.:||:.|.:..::.::|::|::
pombe    72 QLNTANEPHEANDQTSAQSSKLIEAQLPTVED--------RFAKQTNEVDINTHLLNFVEKKLKQ 128

  Fly   138 RKGGGTEDAAEDDGDVNKYLTPEDAALYALPDHLRQSSSHRSEEMLSNQ--MLNGIPEVDLGIVA 200
            .:   ......::|:.|...|..::.:..:     ::|.|.:|......  .|..|.||||||::
pombe   129 ER---LAQNYSENGETNALNTKNESTVQNI-----KNSLHPNEHSFIRDAAALGAIREVDLGIIS 185

  Fly   201 KIRNIEATEEAKQKLLQDAKNKKDGPSQFVPTNMAVNFMQHNRFNIEDNSDQRRRKREEREGNKS 265
                            .|..|.|:|..:           |..|..:::..|.:..:..|    .:
pombe   186 ----------------TDVDNLKNGRKR-----------QKKRARMKEKLDSKALRTSE----DA 219

  Fly   266 AQHQTNPNGVKRATDDYHYDKFRKQFRRY 294
            |:.:.....:|..:.|.......::||.|
pombe   220 ARDEFIEKMLKPISQDEESKGIYRRFRVY 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7974NP_001261273.1 Hep_59 113..214 CDD:284467 20/102 (20%)
SPAC1D4.01NP_001342820.1 Hep_59 104..183 CDD:311171 18/86 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103943
Panther 1 1.100 - - LDO PTHR13486
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.