DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srrm234 and CWC21

DIOPT Version :9

Sequence 1:NP_001097475.2 Gene:Srrm234 / 38206 FlyBaseID:FBgn0035253 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_010770.3 Gene:CWC21 / 852093 SGDID:S000002890 Length:135 Species:Saccharomyces cerevisiae


Alignment Length:107 Identity:41/107 - (38%)
Similarity:61/107 - (57%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YNGIGLTTPRGSGTNGHVQRNWAC---VRP-GKKDKDYRAEDDTKKLD-AQLNRP--PNKEILDH 59
            ||||||.:.:||.|:|||||:.|.   .|| |.:.:..:.::..||.. .:.:||  ..|:|..|
Yeast     3 YNGIGLKSAKGSSTSGHVQRSLASNNRRRPQGSQQQRQQRQNAIKKASHDKASRPLAVQKQIETH 67

  Fly    60 DRKRKIEVKCLELEDILEKQGRTPEE-IKSQVDSFRQKLMGQ 100
            ..||:|||:..||.|.||::....|| |..:.::.|.||..:
Yeast    68 MEKREIEVQVSELRDRLEEEETLSEEQIDKKCEALRAKLTNE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srrm234NP_001097475.2 cwf21 58..98 CDD:285507 16/40 (40%)
MIP-T3 672..>936 CDD:287245
SRRM_C <1584..1610 CDD:291883
CWC21NP_010770.3 cwf21 62..109 CDD:424082 19/46 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003470
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102153
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.