DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srrm234 and cwf21

DIOPT Version :9

Sequence 1:NP_001097475.2 Gene:Srrm234 / 38206 FlyBaseID:FBgn0035253 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_593820.1 Gene:cwf21 / 2543616 PomBaseID:SPAC4A8.09c Length:293 Species:Schizosaccharomyces pombe


Alignment Length:183 Identity:49/183 - (26%)
Similarity:75/183 - (40%) Gaps:45/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YNGIGLTTPRGSGTNGHVQRNWACVRPGKKDKDYRAEDDTKKLDAQLNRPPNKEILDHDRKRKIE 66
            ||||||.|||||||||:|.||.:.|:...|:.:.::..:.|.|:.::..|   .|.:|:.:|:||
pombe     3 YNGIGLPTPRGSGTNGYVMRNLSHVKKYDKNTNLQSNRNAKALEKRVQDP---SISEHECRRQIE 64

  Fly    67 VK-CLELEDILEKQGRTPEEIKSQVDSFRQKLMGQGKTDLAKDEFGRVANTTTSTATAAVRTTAT 130
            .| .|..|.:|       ||:.|           |..||.|..:......|.......|:.....
pombe    65 SKLLLYREQLL-------EEVSS-----------QHSTDAAASDSNTNFGTENPKPPKAIIKDEQ 111

  Fly   131 ASAATASTMTTTTEATTVK-----------------------VAKPKKRRKRR 160
            :.:.|.|......|....|                       :.:|:||::.|
pombe   112 SQSKTKSLDEADVEILVQKYREQLLKELQLQKSTEKGKNFESILQPQKRKETR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srrm234NP_001097475.2 cwf21 58..98 CDD:285507 11/40 (28%)
MIP-T3 672..>936 CDD:287245
SRRM_C <1584..1610 CDD:291883
cwf21NP_593820.1 U2AF_lg 168..>277 CDD:273727
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003470
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102153
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R267
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.