DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7970 and CG14778

DIOPT Version :10

Sequence 1:NP_001303378.1 Gene:CG7970 / 38205 FlyBaseID:FBgn0035252 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_569918.1 Gene:CG14778 / 31100 FlyBaseID:FBgn0029580 Length:186 Species:Drosophila melanogaster


Alignment Length:39 Identity:11/39 - (28%)
Similarity:17/39 - (43%) Gaps:1/39 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 VHNLFLGASMESRASTDNYPAHIPRLEF-HAPMYPRWTP 259
            :.:|..|..|.|.:||....|.:.:..| |.|.:....|
  Fly    25 LESLTTGNGMSSPSSTHANTAPVVQSHFAHRPQHVSSAP 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7970NP_001303378.1 Mpv17_PMP22 177..238 CDD:461182 5/15 (33%)
CG14778NP_569918.1 Mpv17_PMP22 111..172 CDD:461182
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.