DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vta1 and VTA1

DIOPT Version :9

Sequence 1:NP_647640.1 Gene:Vta1 / 38204 FlyBaseID:FBgn0035251 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_057569.2 Gene:VTA1 / 51534 HGNCID:20954 Length:307 Species:Homo sapiens


Alignment Length:329 Identity:154/329 - (46%)
Similarity:203/329 - (61%) Gaps:45/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PPCPPSLKSIQHFLKLAQEHDTRDVVIAYWARLYALQVGLKASTQTGEETKLLLGIMDWLEQMKK 68
            ||.|...|||||.|:.|||||.||.|:||:.||||:|.|:|..::|.|..|.|..:||.||.:||
Human     8 PPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKK 72

  Fly    69 QYAENEAITNEVAAQAHIENYALKLFLYADKQDREENFGKNVVKAFYSSGVLYDILQTFGELSEE 133
            |..:|||||.|:...||:||||||:|||||.:||...|.||::|:||::.:|.|::..||||::|
Human    73 QLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDE 137

  Fly   134 ALHNRKYAKWKAAYIHNCLKNGETPIPGPLPDDDDEAELEGENANASADTSPEDAAGAAAPAPYQ 198
            .:.:||||:|||.||||||||||||..||:..::|. ::| ||         |||..|:.|    
Human   138 NVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDN-DIE-EN---------EDAGAASLP---- 187

  Fly   199 PEPDSQPPAPSSPTT-----------SGV-VPPTAEEVLNNPNKLP-SPPVDEEKPGGFVPYVPT 250
                :||..|||.:|           :|: :||.|....|.|.::| |..|...          |
Human   188 ----TQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHSTGVASN----------T 238

  Fly   251 AQPNPATAATIYQPI---VPVAGVQITPDQMITAQKYCKYAGSALNYDDVKTAIENLQKALKLLS 312
            .||.|.|...|...:   :....|::||:....||||||||||||.|:||.||::|||||||||:
Human   239 IQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALKLLT 303

  Fly   313 TGSE 316
            ||.|
Human   304 TGRE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vta1NP_647640.1 Vta1 18..148 CDD:398366 69/129 (53%)
Vta1_C 275..311 CDD:407932 25/35 (71%)
VTA1NP_057569.2 Interaction with IST1 2..186 100/188 (53%)
Interaction with CHMP5 2..75 37/66 (56%)
Vta1 22..152 CDD:309683 69/129 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..233 19/61 (31%)
Interaction with VPS4B. /evidence=ECO:0000250 198..307 47/118 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158245
Domainoid 1 1.000 180 1.000 Domainoid score I3523
eggNOG 1 0.900 - - E1_KOG0917
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6473
Inparanoid 1 1.050 278 1.000 Inparanoid score I2935
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56589
OrthoDB 1 1.010 - - D1450538at2759
OrthoFinder 1 1.000 - - FOG0006035
OrthoInspector 1 1.000 - - oto89571
orthoMCL 1 0.900 - - OOG6_102826
Panther 1 1.100 - - LDO PTHR46009
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1664
SonicParanoid 1 1.000 - - X4945
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.