DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13920 and tmem35

DIOPT Version :9

Sequence 1:NP_001286902.1 Gene:CG13920 / 38203 FlyBaseID:FBgn0025712 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001014335.2 Gene:tmem35 / 791920 ZFINID:ZDB-GENE-030815-1 Length:160 Species:Danio rerio


Alignment Length:129 Identity:54/129 - (41%)
Similarity:81/129 - (62%) Gaps:3/129 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIVLKSLSVLLGLFFIFVGTLKLTPHISKDLYKDLRTEYVKYAKVFPLTALFGVKIPSKWYRRTV 71
            |:.:.:||..|||||:|:||:||||.:|||.|.:::..|..|||..|.....||.  |...|:.:
Zfish     6 TVTIVALSFALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYAKALPALKKMGVS--SVLLRKII 68

  Fly    72 GILEIVCGLAMALIPYHKVKNTANVTLLVLMLLGIYQHWMVSDPFERSGPALVFTFMLGGRLVV 135
            |.||:.||:.:.|:| .:.|:.||..||::||..::.|.:|.||.:|...||||..:|..||::
Zfish    69 GTLEVGCGIVLTLVP-GRPKDVANFILLLVMLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13920NP_001286902.1 DoxX_2 13..131 CDD:404454 51/117 (44%)
tmem35NP_001014335.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596508
Domainoid 1 1.000 99 1.000 Domainoid score I7062
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11008
Inparanoid 1 1.050 105 1.000 Inparanoid score I4923
OMA 1 1.010 - - QHG45664
OrthoDB 1 1.010 - - D1615454at2759
OrthoFinder 1 1.000 - - FOG0008074
OrthoInspector 1 1.000 - - oto40886
orthoMCL 1 0.900 - - OOG6_107968
Panther 1 1.100 - - LDO PTHR13163
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5256
SonicParanoid 1 1.000 - - X6024
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.