DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13920 and Tmem35a

DIOPT Version :9

Sequence 1:NP_001286902.1 Gene:CG13920 / 38203 FlyBaseID:FBgn0025712 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_080515.1 Gene:Tmem35a / 67564 MGIID:1914814 Length:167 Species:Mus musculus


Alignment Length:129 Identity:55/129 - (42%)
Similarity:83/129 - (64%) Gaps:3/129 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIVLKSLSVLLGLFFIFVGTLKLTPHISKDLYKDLRTEYVKYAKVFPLTALFGVKIPSKWYRRTV 71
            ||.:.:|||.|||||:|:||:||||.:|||.|.:::..|..|.:..||....|:.  |...|:::
Mouse     6 TITIMALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN--SILLRKSI 68

  Fly    72 GILEIVCGLAMALIPYHKVKNTANVTLLVLMLLGIYQHWMVSDPFERSGPALVFTFMLGGRLVV 135
            |.||:.||:.|.|:| .:.|:.||..||:|:|..::.|.:|.||.:|...||||..:|..||::
Mouse    69 GALEVACGIVMTLVP-GRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13920NP_001286902.1 DoxX_2 13..131 CDD:404454 51/117 (44%)
Tmem35aNP_080515.1 Interaction with NGFR. /evidence=ECO:0000250|UniProtKB:Q6JAM9 43..54 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850543
Domainoid 1 1.000 101 1.000 Domainoid score I6944
eggNOG 1 0.900 - - E1_2CJ0A
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11008
Inparanoid 1 1.050 109 1.000 Inparanoid score I4882
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45664
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008074
OrthoInspector 1 1.000 - - oto91956
orthoMCL 1 0.900 - - OOG6_107968
Panther 1 1.100 - - LDO PTHR13163
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5256
SonicParanoid 1 1.000 - - X6024
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.