DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13920 and TMEM35B

DIOPT Version :9

Sequence 1:NP_001286902.1 Gene:CG13920 / 38203 FlyBaseID:FBgn0025712 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001182085.1 Gene:TMEM35B / 100506144 HGNCID:40021 Length:154 Species:Homo sapiens


Alignment Length:139 Identity:44/139 - (31%)
Similarity:77/139 - (55%) Gaps:8/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IVLKSLSVLLGLFFIFVGTLKLTPHISKDLYKDLRTEYVKYAKVFPLTALFGVKIPSKWYRRTVG 72
            ::|..|.||||.||..||..||:..||..:.:.:...:|::|:|||| .:||.:.....|:..||
Human     3 LLLSVLRVLLGGFFALVGLAKLSEEISAPVSERMNALFVQFAEVFPL-KVFGYQPDPLNYQIAVG 66

  Fly    73 ILEIVCGLAMALIPYHKVKNTANVTLLVLMLLGIYQHWMVSDPFERSGPALV---FTFMLG-GRL 133
            .||::.||.:.:.| ..::..:|:.|::||:..|:....:.:......||:|   |..:|. |:|
Human    67 FLELLAGLLLVMGP-PMLQEISNLFLILLMMGAIFTLAALKESLSTCIPAIVCLGFLLLLNVGQL 130

  Fly   134 VVWYQTARL 142
            :.  ||.::
Human   131 LA--QTKKV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13920NP_001286902.1 DoxX_2 13..131 CDD:404454 39/121 (32%)
TMEM35BNP_001182085.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160169
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJ0A
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.