DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13920 and tmem35a

DIOPT Version :9

Sequence 1:NP_001286902.1 Gene:CG13920 / 38203 FlyBaseID:FBgn0025712 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_001090850.1 Gene:tmem35a / 100038262 XenbaseID:XB-GENE-957194 Length:162 Species:Xenopus tropicalis


Alignment Length:129 Identity:56/129 - (43%)
Similarity:85/129 - (65%) Gaps:3/129 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIVLKSLSVLLGLFFIFVGTLKLTPHISKDLYKDLRTEYVKYAKVFPLTALFGVKIPSKWYRRTV 71
            |:.:.:|||.|||||:|:||:||||.:|||.|.:::..|..|.|..|  ||..:.|.|.:.|:.:
 Frog     6 TVTIVALSVTLGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVKALP--ALKKIGISSVFLRKAI 68

  Fly    72 GILEIVCGLAMALIPYHKVKNTANVTLLVLMLLGIYQHWMVSDPFERSGPALVFTFMLGGRLVV 135
            |.||:.||:.:.|:| .:.|:.||..||:|:|:.::.|.:|.||.:|...||||..:|..||:|
 Frog    69 GSLELACGIVLTLVP-GRPKDVANFILLLLVLIVLFFHQLVGDPLKRYAHALVFGILLTCRLLV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13920NP_001286902.1 DoxX_2 13..131 CDD:404454 52/117 (44%)
tmem35aNP_001090850.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6803
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11008
Inparanoid 1 1.050 109 1.000 Inparanoid score I4751
OMA 1 1.010 - - QHG45664
OrthoDB 1 1.010 - - D1615454at2759
OrthoFinder 1 1.000 - - FOG0008074
OrthoInspector 1 1.000 - - oto102269
Panther 1 1.100 - - LDO PTHR13163
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5256
SonicParanoid 1 1.000 - - X6024
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.