DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bro and cbfb

DIOPT Version :9

Sequence 1:NP_477066.2 Gene:Bro / 38202 FlyBaseID:FBgn0013755 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_009291805.1 Gene:cbfb / 30744 ZFINID:ZDB-GENE-980526-440 Length:201 Species:Danio rerio


Alignment Length:180 Identity:93/180 - (51%)
Similarity:119/180 - (66%) Gaps:16/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MPRVVPDQRSKFDSDELFRRLSRESEVRYTGYRERAMEERRMRFVNDCRKGYAEISMVASGTNLQ 101
            ||||||||||||:::|.||:||||.|::|||:|:|..|||:.||.|.||.|.:||:.||:||||.
Zfish     1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLS 65

  Fly   102 L-YFNAN-HNPYAQ---EQDCDFERERGKVHLRSSFIMNGVCVRFRGWVDLDRLDGAACLEFDEQ 161
            | :|.|| |....|   .:..|||||.|||:|::..|:|||||.:|||:||.||||..|||:|::
Zfish    66 LQFFPANLHGDQRQAPTREYVDFERETGKVYLKAPMILNGVCVIWRGWLDLHRLDGMGCLEYDDE 130

  Fly   162 RAQQEDAQLQEQIQSYNQRMAESRRIYHTPQTPPEDHHHRGGPGLPRGPM 211
            |||.|||..|...:       |:||  .|......|..||  ..|.:.||
Zfish   131 RAQHEDALAQAAFE-------EARR--RTRDFEDRDRSHR--EDLEQMPM 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BroNP_477066.2 CBF_beta 37..192 CDD:280473 87/159 (55%)
cbfbXP_009291805.1 CBF_beta 1..162 CDD:280473 90/171 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586539
Domainoid 1 1.000 187 1.000 Domainoid score I3269
eggNOG 1 0.900 - - E1_KOG4785
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3910
OMA 1 1.010 - - QHG49951
OrthoDB 1 1.010 - - D1254153at2759
OrthoFinder 1 1.000 - - FOG0005775
OrthoInspector 1 1.000 - - otm25838
orthoMCL 1 0.900 - - OOG6_108102
Panther 1 1.100 - - O PTHR10276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5552
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.