DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bro and bro-1

DIOPT Version :10

Sequence 1:NP_477066.2 Gene:Bro / 38202 FlyBaseID:FBgn0013755 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_491542.1 Gene:bro-1 / 172158 WormBaseID:WBGene00000272 Length:152 Species:Caenorhabditis elegans


Alignment Length:140 Identity:30/140 - (21%)
Similarity:61/140 - (43%) Gaps:21/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MPRVVPDQRSKFDSDELFRRLSRESEVRYTGYRERAMEERRMRFVNDCRKGYAEISMVASGTNLQ 101
            |.|...||:|.|.:|....:||..:|.:::.:....:.|||.||.....:....::...:|.|:.
 Worm     1 MKRTTTDQQSSFQTDYFLTQLSHFTEAKFSLFEHAPLSERRERFRVHVERDEMPLTFCKTGINIP 65

  Fly   102 L---YFNANHNPYAQEQDCDFERERGKVHLRS-SFIMNGVCVRFRGWVDLDRLDGAACLEFDEQR 162
            :   :...|.|               ::..|| ..:.||:.|:..|.::.:.|:|.  :.|:..:
 Worm    66 VKLEWSQTNGN---------------EISFRSRPLVFNGIWVKVIGAMNSESLEGR--VRFERFQ 113

  Fly   163 AQQEDAQLQE 172
            .::.|..:.|
 Worm   114 REKRDRVISE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BroNP_477066.2 CBF_beta 37..195 CDD:396750 30/140 (21%)
bro-1NP_491542.1 CBF_beta 1..144 CDD:396750 30/140 (21%)

Return to query results.
Submit another query.