DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13919 and TMEM60

DIOPT Version :9

Sequence 1:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_116325.1 Gene:TMEM60 / 85025 HGNCID:21754 Length:133 Species:Homo sapiens


Alignment Length:134 Identity:41/134 - (30%)
Similarity:67/134 - (50%) Gaps:20/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLAHRALFTWFIVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIYVIIKFIRKWRNLTCL 65
            |:||.|.|.||...|:|||:|.|:||.:..||||:.|.|:|.||.|:::.:|:|...:     |.
Human     3 MSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVLLIVKMAGR-----CK 62

  Fly    66 TDL--------LFLYKWNIAGVLLTIASQVMICLTLEYPQQ-------IPIYVTVAPVILLLSTA 115
            :..        :....|.:..:||.:|..:.:|..||....       ||::..:|..:..|...
Human    63 SGFDPRHGSHNIKKKAWYLIAMLLKLAFCLALCAKLEQFTTMNLSYVFIPLWALLAGALTELGYN 127

  Fly   116 IFYV 119
            :|:|
Human   128 VFFV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13919NP_647637.1 None
TMEM60NP_116325.1 Tmemb_185A 25..>118 CDD:313495 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3879
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5267
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45648
OrthoDB 1 1.010 - - D1512798at2759
OrthoFinder 1 1.000 - - FOG0009901
OrthoInspector 1 1.000 - - oto90996
orthoMCL 1 0.900 - - OOG6_110130
Panther 1 1.100 - - LDO PTHR13568
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5770
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.