DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13919 and TMEM185B

DIOPT Version :10

Sequence 1:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_077026.2 Gene:TMEM185B / 79134 HGNCID:18896 Length:350 Species:Homo sapiens


Alignment Length:126 Identity:35/126 - (27%)
Similarity:55/126 - (43%) Gaps:14/126 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLVFLILLCLRLDPRTTWNWFVTFTPLWF---FDVIIIIYVIIKFIRKWRNLTCL-----TDLLF 70
            :|.| |.:.|:||....|.|.|.|.|||.   |..::::|.|:..:...|:|..:     |.:..
Human   150 ILQF-IFIALKLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTM 213

  Fly    71 LYKW-NIAGVLLTIASQVMICLTLEYPQQIPIYVTV-APVILLLSTAIFYVGSRLGKREGW 129
            ...| .|...|||.  :|::...|:...... ||:: .|:.|.|.|.:.....|.|....|
Human   214 AISWITIVVPLLTF--EVLLVHRLDGHNTFS-YVSIFVPLWLSLLTLMATTFRRKGGNHWW 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13919NP_647637.1 None
TMEM185BNP_077026.2 Tmemb_185A 31..253 CDD:402059 29/106 (27%)

Return to query results.
Submit another query.