DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13919 and tmem185

DIOPT Version :9

Sequence 1:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_956731.1 Gene:tmem185 / 393409 ZFINID:ZDB-GENE-040426-1167 Length:351 Species:Danio rerio


Alignment Length:113 Identity:31/113 - (27%)
Similarity:54/113 - (47%) Gaps:13/113 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLVFLILLCLRLDPRTTWNWFVTFTPLWF---FDVIIIIYVIIKFIRKWRNLTCL-----TDLLF 70
            :|.| |.:.|:||...:|.|.|...|||.   |..::::|.|:..:...|::..:     |.:..
Zfish   151 ILQF-IFIALKLDGIISWPWLVVCVPLWILMSFLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITM 214

  Fly    71 LYKW-NIAGVLLTIASQVMICLTLEY-PQQIPIYVT--VAPVILLLST 114
            ...| .|...|||....::..|...| |..:|::|.  |:.|.|:::|
Zfish   215 AISWMTIVVPLLTFEILLVHKLDNHYSPNYVPVFVPLWVSLVTLMVTT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13919NP_647637.1 None
tmem185NP_956731.1 Tmemb_185A 33..254 CDD:287271 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3879
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.