DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13919 and Tmem185a

DIOPT Version :9

Sequence 1:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001129184.1 Gene:Tmem185a / 309357 RGDID:1563037 Length:350 Species:Rattus norvegicus


Alignment Length:169 Identity:40/169 - (23%)
Similarity:69/169 - (40%) Gaps:51/169 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RALFTWF---------IVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIYVIIKFIRKW-R 60
            |.||..|         .:|:|.:||.||||....|:::..|.|:|.:.:::|:...:. ...| |
  Rat     4 RGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASVG-TGVWAR 67

  Fly    61 N-------LTCLTDLLFLYKWNIAGV---LLTIASQVMICLTLEYPQQ------IPIY----VTV 105
            |       .||:.     :|..:..|   ||.:..:|::|..:|....      :|::    |:|
  Rat    68 NPQYRAEGETCVE-----FKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLFFVSPVSV 127

  Fly   106 APVI------------LLLSTAI---FYVGSRLGKREGW 129
            |..:            :|.|..|   .::..||.|...|
  Rat   128 AACVWGFRHDRSLELEILCSVNILQFIFIALRLDKIIHW 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13919NP_647637.1 None
Tmem185aNP_001129184.1 Tmemb_185A 31..253 CDD:402059 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3879
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.