DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13919 and Tmem185a

DIOPT Version :10

Sequence 1:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001344679.1 Gene:Tmem185a / 236848 MGIID:2448555 Length:350 Species:Mus musculus


Alignment Length:169 Identity:40/169 - (23%)
Similarity:69/169 - (40%) Gaps:51/169 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RALFTWF---------IVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIYVIIKFIRKW-R 60
            |.||..|         .:|:|.:||.||||....|:::..|.|:|.:.:::|:...:. ...| |
Mouse     4 RGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASVG-TGVWAR 67

  Fly    61 N-------LTCLTDLLFLYKWNIAGV---LLTIASQVMICLTLEYPQQ------IPIY----VTV 105
            |       .||:.     :|..:..|   ||.:..:|::|..:|....      :|::    |:|
Mouse    68 NPQYRAEGETCVE-----FKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLFFVSPVSV 127

  Fly   106 APVI------------LLLSTAI---FYVGSRLGKREGW 129
            |..:            :|.|..|   .::..||.|...|
Mouse   128 AACVWGFRHDRSLELEILCSVNILQFIFIALRLDKIIHW 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13919NP_647637.1 None
Tmem185aNP_001344679.1 Tmemb_185A 31..253 CDD:402059 31/142 (22%)
Mediates interaction with MAP1B. /evidence=ECO:0000250 298..350
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.