DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13919 and LOC100361056

DIOPT Version :9

Sequence 1:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster
Sequence 2:XP_006253041.1 Gene:LOC100361056 / 100361056 RGDID:2320904 Length:134 Species:Rattus norvegicus


Alignment Length:136 Identity:40/136 - (29%)
Similarity:63/136 - (46%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLAHRALFTWFIVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIYVIIKF---------- 55
            |:||.|.|..|...|:|.|:|.|.||.:..||||:.|.|:|.||.|:::.:|:|.          
  Rat     3 MSLAQRVLLAWLFTLLFFIMLVLELDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGRCKSGFDP 67

  Fly    56 ------IRKWRNLTCLTDLLFLYKWNIAGVLLTIASQVMICLTLEYPQQIPIYVTVAPVILLLST 114
                  |:|.:            .|.:..:||.:|..:.:|..||....|.:.....|:..||:.
  Rat    68 RHGSHNIKKKK------------PWYLITMLLKLAFCLALCAKLEQFTTISLSYVFIPLWALLAG 120

  Fly   115 AIFYVG 120
            |:..:|
  Rat   121 ALTELG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13919NP_647637.1 None
LOC100361056XP_006253041.1 Tmemb_185A 25..>119 CDD:287271 27/105 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.