DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13919 and tmem60

DIOPT Version :9

Sequence 1:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001120020.1 Gene:tmem60 / 100144982 XenbaseID:XB-GENE-942110 Length:134 Species:Xenopus tropicalis


Alignment Length:134 Identity:42/134 - (31%)
Similarity:68/134 - (50%) Gaps:20/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLAHRALFTWFIVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIYVIIKFIRKWRNLTCL 65
            |:||.|.|.||...|:|||:|.|:||.:..||||:.|.|:|.||.|:::.:|:|...:     |.
 Frog     3 MSLAQRVLLTWLFTLLFLIMLVLKLDEKAPWNWFIIFIPVWIFDTILLVMLIVKMAGR-----CK 62

  Fly    66 TDL--------LFLYKWNIAGVLLTIASQVMICLTLEYPQQ-------IPIYVTVAPVILLLSTA 115
            :..        |....|.:..:||.:|..:.:|..||....       ||:::.:...::.|...
 Frog    63 SGYDPRNGAQHLKKKSWYLTAMLLKLAFCLALCAKLEQSANIYLCFVFIPLWILLLGGLIELGYN 127

  Fly   116 IFYV 119
            :|||
 Frog   128 VFYV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13919NP_647637.1 None
tmem60NP_001120020.1 Tmemb_185A 25..>112 CDD:370938 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5054
OMA 1 1.010 - - QHG45648
OrthoDB 1 1.010 - - D1512798at2759
OrthoFinder 1 1.000 - - FOG0009901
OrthoInspector 1 1.000 - - oto104782
Panther 1 1.100 - - LDO PTHR13568
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5770
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.110

Return to query results.
Submit another query.