DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARF6 and dnd

DIOPT Version :9

Sequence 1:NP_001654.1 Gene:ARF6 / 382 HGNCID:659 Length:175 Species:Homo sapiens
Sequence 2:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster


Alignment Length:178 Identity:84/178 - (47%)
Similarity:113/178 - (63%) Gaps:4/178 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MG--KVLSKIFGN--KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNV 61
            ||  .:|.|:..|  ||.|||:||||.|||||||.:|......|..||.|||:::|.....|.||
  Fly     1 MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNV 65

Human    62 WDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDL 126
            ||:|||.||||.|::|:..|..||:|:||.||.|:.||..||..::.|..::...:||||||||:
  Fly    66 WDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDM 130

Human   127 PDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK 174
            ||||...|:.||:.|.:::.|.|.::...|..|.||.||:.|:..|.|
  Fly   131 PDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARF6NP_001654.1 ARF 1..175 CDD:128474 84/178 (47%)
dndNP_650995.1 Arl3 3..176 CDD:206721 80/172 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.