DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bgb and CBFB

DIOPT Version :9

Sequence 1:NP_001261271.1 Gene:Bgb / 38198 FlyBaseID:FBgn0013753 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_074036.1 Gene:CBFB / 865 HGNCID:1539 Length:187 Species:Homo sapiens


Alignment Length:186 Identity:96/186 - (51%)
Similarity:129/186 - (69%) Gaps:15/186 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MPRVVPDQKSKFESDELFRRLSRESEVRYTGYRERSIEERQVRFMNGCREGHTEASFVASGTNLQ 94
            ||||||||:||||::|.||:||||.|::|||:|:|..||||.||.|.||:|.:|.:|||:||||.
Human     1 MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLS 65

  Fly    95 LVF-------NANQNPYLHDKE-CDFDKEHGKVHIKSYFIMNGVCVRFRGWIDLERLDGVGCLEY 151
            |.|       ...|.|   .:| .|.::|.|||::|:..|:|||||.::|||||:||||:||||:
Human    66 LQFFPASWQGEQRQTP---SREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEF 127

  Fly   152 DERRAMHEDAILRDQIDRYNQRLREFEDTKRAYRDNRQDEMEAVRRGVASGGIGVG 207
            ||.||..|||:.:...:...:|.|||||..|::|    :||||.|:...|.|..:|
Human   128 DEERAQQEDALAQQAFEEARRRTREFEDRDRSHR----EEMEARRQQDPSPGSNLG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BgbNP_001261271.1 CBF_beta 30..189 CDD:280473 88/166 (53%)
CBFBNP_074036.1 CBF_beta 1..167 CDD:396750 91/172 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151988
Domainoid 1 1.000 183 1.000 Domainoid score I3429
eggNOG 1 0.900 - - E1_KOG4785
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11173
Inparanoid 1 1.050 183 1.000 Inparanoid score I3976
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49951
OrthoDB 1 1.010 - - D1254153at2759
OrthoFinder 1 1.000 - - FOG0005775
OrthoInspector 1 1.000 - - otm40645
orthoMCL 1 0.900 - - OOG6_108102
Panther 1 1.100 - - LDO PTHR10276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5552
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.770

Return to query results.
Submit another query.