DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bgb and Bro

DIOPT Version :9

Sequence 1:NP_001261271.1 Gene:Bgb / 38198 FlyBaseID:FBgn0013753 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_477066.2 Gene:Bro / 38202 FlyBaseID:FBgn0013755 Length:213 Species:Drosophila melanogaster


Alignment Length:235 Identity:131/235 - (55%)
Similarity:162/235 - (68%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AALANMI-PYDTIGLYEQPKPRFIFKMPRVVPDQKSKFESDELFRRLSRESEVRYTGYRERSIEE 68
            ||:..|| ||:.:.:|||||||||||||||||||:|||:||||||||||||||||||||||::||
  Fly    11 AAMNGMIPPYEAMAMYEQPKPRFIFKMPRVVPDQRSKFDSDELFRRLSRESEVRYTGYRERAMEE 75

  Fly    69 RQVRFMNGCREGHTEASFVASGTNLQLVFNANQNPYLHDKECDFDKEHGKVHIKSYFIMNGVCVR 133
            |::||:|.||:|:.|.|.|||||||||.||||.|||..:::|||::|.||||::|.|||||||||
  Fly    76 RRMRFVNDCRKGYAEISMVASGTNLQLYFNANHNPYAQEQDCDFERERGKVHLRSSFIMNGVCVR 140

  Fly   134 FRGWIDLERLDGVGCLEYDERRAMHEDAILRDQIDRYNQRLREFEDTKRAYRDNRQDEMEAVRRG 198
            ||||:||:||||..|||:||:||..|||.|::||..||||:.|   ::|.|..            
  Fly   141 FRGWVDLDRLDGAACLEFDEQRAQQEDAQLQEQIQSYNQRMAE---SRRIYHT------------ 190

  Fly   199 VASGGIGVGASMWRRXLDLWTAPGPSHPQLPPQQQQTHHQ 238
                                       ||.||:..  ||:
  Fly   191 ---------------------------PQTPPEDH--HHR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BgbNP_001261271.1 CBF_beta 30..189 CDD:280473 108/158 (68%)
BroNP_477066.2 CBF_beta 37..192 CDD:280473 108/196 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456659
Domainoid 1 1.000 187 1.000 Domainoid score I3269
eggNOG 1 0.900 - - E1_KOG4785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3910
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49951
OrthoDB 1 1.010 - - D1254153at2759
OrthoFinder 1 1.000 - - FOG0005775
OrthoInspector 1 1.000 - - otm25838
orthoMCL 1 0.900 - - OOG6_108102
Panther 1 1.100 - - P PTHR10276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5552
1211.810

Return to query results.
Submit another query.