DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bgb and bro-1

DIOPT Version :9

Sequence 1:NP_001261271.1 Gene:Bgb / 38198 FlyBaseID:FBgn0013753 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_491542.1 Gene:bro-1 / 172158 WormBaseID:WBGene00000272 Length:152 Species:Caenorhabditis elegans


Alignment Length:168 Identity:38/168 - (22%)
Similarity:67/168 - (39%) Gaps:21/168 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MPRVVPDQKSKFESDELFRRLSRESEVRYTGYRERSIEERQVRFMNGCREGHTEASFVASGTNLQ 94
            |.|...||:|.|::|....:||..:|.:::.:....:.||:.||...........:|..:|.|:.
 Worm     1 MKRTTTDQQSSFQTDYFLTQLSHFTEAKFSLFEHAPLSERRERFRVHVERDEMPLTFCKTGINIP 65

  Fly    95 LVFNANQNPYLHDKECDFDKEHGKVHIKSYFIMNGVCVRFRGWIDLERLDGVGCLEYDERRAMHE 159
            :....:|.   :..|..|....        .:.||:.|:..|.::.|.|:|....|..:|..   
 Worm    66 VKLEWSQT---NGNEISFRSRP--------LVFNGIWVKVIGAMNSESLEGRVRFERFQREK--- 116

  Fly   160 DAILRDQIDRYNQRLREFEDTKRAYRDNRQDEMEAVRR 197
                ||::........|.|:......|   .|:.|:||
 Worm   117 ----RDRVISETFVFPEVEEEPIGLTD---AEIAALRR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BgbNP_001261271.1 CBF_beta 30..189 CDD:280473 34/158 (22%)
bro-1NP_491542.1 CBF_beta 1..142 CDD:280473 34/161 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162247
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005775
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108102
Panther 1 1.100 - - LDO PTHR10276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.