DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bgb and cbfb

DIOPT Version :9

Sequence 1:NP_001261271.1 Gene:Bgb / 38198 FlyBaseID:FBgn0013753 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002937211.2 Gene:cbfb / 100270773 XenbaseID:XB-GENE-1016003 Length:185 Species:Xenopus tropicalis


Alignment Length:188 Identity:97/188 - (51%)
Similarity:132/188 - (70%) Gaps:19/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 MPRVVPDQKSKFESDELFRRLSRESEVRYTGYRERSIEERQVRFMNGCREGHTEASFVASGTNLQ 94
            ||||||||::|||::|.||:|:||||::|||:|:|..||||.||.|.||:|.:|.:|||:||||.
 Frog     1 MPRVVPDQRAKFENEEFFRKLNRESEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLS 65

  Fly    95 LVF----------NANQNPYLHDKECDFDKEHGKVHIKSYFIMNGVCVRFRGWIDLERLDGVGCL 149
            |.|          .|....|:     ||::|.||||:|:..|:|||||.::|||||:||||:|||
 Frog    66 LQFFPANWQGEPRQAPTREYV-----DFEREPGKVHLKAPMILNGVCVLWKGWIDLQRLDGMGCL 125

  Fly   150 EYDERRAMHEDAILRDQIDRYNQRLREFEDTKRAYRDNRQDEMEAVRRGVASGGIGVG 207
            |:|:.||.||||:.:...:...:|.|||||..|::|    :||||.|:...|.|:|.|
 Frog   126 EFDDDRAQHEDALAQQAFEEARRRTREFEDRDRSHR----EEMEARRQQDPSSGLGGG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BgbNP_001261271.1 CBF_beta 30..189 CDD:280473 88/168 (52%)
cbfbXP_002937211.2 CBF_beta 1..167 CDD:367030 91/174 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6355
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11173
Inparanoid 1 1.050 181 1.000 Inparanoid score I3865
OMA 1 1.010 - - QHG49951
OrthoDB 1 1.010 - - D1254153at2759
OrthoFinder 1 1.000 - - FOG0005775
OrthoInspector 1 1.000 - - otm47822
Panther 1 1.100 - - LDO PTHR10276
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4481
SonicParanoid 1 1.000 - - X5552
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.