| Sequence 1: | NP_647636.3 | Gene: | Mettl2 / 38197 | FlyBaseID: | FBgn0035247 | Length: | 325 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001366974.1 | Gene: | nsun-5 / 175153 | WormBaseID: | WBGene00013151 | Length: | 439 | Species: | Caenorhabditis elegans |
| Alignment Length: | 51 | Identity: | 14/51 - (27%) |
|---|---|---|---|
| Similarity: | 24/51 - (47%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 253 LRFKSGKCMEDNFYVRGDGTMVYFFTEEELRGMMTQAGLQEEQLIVDRRLQ 303 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Mettl2 | NP_647636.3 | Methyltransf_25 | 136..238 | CDD:463945 | |
| COG4627 | 187..308 | CDD:443666 | 14/51 (27%) | ||
| nsun-5 | NP_001366974.1 | RsmB | <143..436 | CDD:439914 | |
| Blue background indicates that the domain is not in the aligned region. | |||||