DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and SNC2

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_014972.3 Gene:SNC2 / 854505 SGDID:S000005854 Length:115 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:31/117 - (26%)
Similarity:65/117 - (55%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLS 71
            :...|.:...|..|...|   ..|::..:.||.::      ::|:.|.|||.|:.||.||..:|:
Yeast     2 SSSVPYDPYVPPEESNSG---ANPNSQNKTAALRQ------EIDDTVGIMRDNINKVAERGERLT 57

  Fly    72 ELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKP 123
            .::|:||.|...|..|::.|.:::::.|.::|||.:.:.::.::::.:|..|
Yeast    58 SIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLVVIILLVVIIVP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 22/80 (28%)
R-SNARE_VAMP2 40..102 CDD:277223 19/61 (31%)
SNC2NP_014972.3 SNC1 <1..96 CDD:227472 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I2186
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - mtm9203
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.