DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and SNC1

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_009372.1 Gene:SNC1 / 851203 SGDID:S000000028 Length:117 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:29/91 - (31%)
Similarity:59/91 - (64%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRK 97
            ||.:.::.|..:.||::|:.|.|||.|:.||.||..:|:.::|:||.|...|..|::.|.::::.
Yeast    20 PQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKA 84

  Fly    98 FWLQNLKMMIIMGVIGLVVVGIIAKP 123
            .|.::|||.:.:.::.::::.:|..|
Yeast    85 MWYKDLKMKMCLALVIIILLVVIIVP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 25/80 (31%)
R-SNARE_VAMP2 40..102 CDD:277223 22/61 (36%)
SNC1NP_009372.1 SNC1 <1..117 CDD:227472 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I2186
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - mtm9203
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.