DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and VAMP726

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001323352.1 Gene:VAMP726 / 839424 AraportID:AT1G04760 Length:220 Species:Arabidopsis thaliana


Alignment Length:90 Identity:34/90 - (37%)
Similarity:58/90 - (64%) Gaps:4/90 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKR 96
            :|::|:   :|.:.:|||.||..:|..|:||||:|..|:..|.|:.:.|:..|..|..|..|:||
plant   124 HPEEIS---KLSKVKAQVTEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTKMKR 185

  Fly    97 KFWLQNLKM-MIIMGVIGLVVVGII 120
            |.|.:|:|: :|:.|:|..:::.||
plant   186 KLWFENMKIKLIVFGIIVALILIII 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 30/81 (37%)
R-SNARE_VAMP2 40..102 CDD:277223 25/61 (41%)
VAMP726NP_001323352.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3265
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.