powered by:
Protein Alignment nSyb and ATYKT62
DIOPT Version :9
Sequence 1: | NP_001261269.1 |
Gene: | nSyb / 38196 |
FlyBaseID: | FBgn0013342 |
Length: | 206 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001318826.1 |
Gene: | ATYKT62 / 835930 |
AraportID: | AT5G58180 |
Length: | 199 |
Species: | Arabidopsis thaliana |
Alignment Length: | 57 |
Identity: | 17/57 - (29%) |
Similarity: | 29/57 - (50%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 AAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGK 93
|...:|.:.|.::||...|:...::.||.|..||..|.:::..|...:..|.:||.|
plant 135 AEADKLLKIQRELDETKIILHKTIDGVLARGEKLDSLVEKSSELSLASKMFYKQAKK 191
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5143 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.