DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and VAMP714

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_197628.1 Gene:VAMP714 / 832297 AraportID:AT5G22360 Length:221 Species:Arabidopsis thaliana


Alignment Length:79 Identity:21/79 - (26%)
Similarity:49/79 - (62%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMM 106
            |.:.:.:|.|:..:|..|:||::||..::..|.|:...:|..:..|.:|:.:|:|..|::|.|::
plant   128 LNRVRGEVSEIRSVMVENIEKIMERGDRIELLVDKTATMQDSSFHFRKQSKRLRRALWMKNAKLL 192

  Fly   107 IIMGVIGLVVVGII 120
            :::..:.:.::.||
plant   193 VLLTCLIVFLLYII 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 19/77 (25%)
R-SNARE_VAMP2 40..102 CDD:277223 17/59 (29%)
VAMP714NP_197628.1 Longin 4..119 CDD:341428
Synaptobrevin 124..212 CDD:395764 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.