DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and VAMP2

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001317054.1 Gene:VAMP2 / 6844 HGNCID:12643 Length:118 Species:Homo sapiens


Alignment Length:120 Identity:78/120 - (65%)
Similarity:89/120 - (74%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADAAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLE 65
            |..:|.|..|||  .|||||||.      |..|..:.:.:|||||||||||||||||.||:||||
Human     1 MDRSATAATAPP--AAPAGEGGP------PAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLE 57

  Fly    66 RDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII 120
            ||.|||||||||||||.||||||..|.|||||:|.:|||||||:|||..:::.||
Human    58 RDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIII 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 61/80 (76%)
R-SNARE_VAMP2 40..102 CDD:277223 51/61 (84%)
VAMP2NP_001317054.1 R-SNARE_VAMP2 32..94 CDD:277223 51/61 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7591
Inparanoid 1 1.050 141 1.000 Inparanoid score I4485
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - mtm8557
orthoMCL 1 0.900 - - OOG6_103752
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 1 1.000 - - X424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.850

Return to query results.
Submit another query.