DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and Vamp4

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001334054.1 Gene:Vamp4 / 53330 MGIID:1858730 Length:141 Species:Mus musculus


Alignment Length:99 Identity:31/99 - (31%)
Similarity:59/99 - (59%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGK 93
            ||..|:......:::..|.|||||:|:|:.|:.||:||..:|.||.|::::|...|:.|..::.:
Mouse    40 GPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQ 104

  Fly    94 LKRKFWLQNLKMMIIMGVIG-----LVVVGIIAK 122
            |:|:.|.:..|:..||.:..     ::::.|:.|
Mouse   105 LRRQMWWRGCKIKAIMALAAAILLLMIIILIVVK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 26/85 (31%)
R-SNARE_VAMP2 40..102 CDD:277223 23/61 (38%)
Vamp4NP_001334054.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 3/10 (30%)
R-SNARE_VAMP4 50..116 CDD:277222 23/65 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.