DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and vamp1b

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001002532.1 Gene:vamp1b / 436805 ZFINID:ZDB-GENE-040718-265 Length:118 Species:Danio rerio


Alignment Length:114 Identity:78/114 - (68%)
Similarity:86/114 - (75%) Gaps:5/114 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLS 71
            |.||.| ||||.|.||    .|.|..|....:.:|||||||||:|||||||.||:||||||.|||
Zfish     4 ADDANP-AGAPGGPGG----AGAPAPPPNTTSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLS 63

  Fly    72 ELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII 120
            ||||||||||.||||||..|.|||.|:|.:|.||||||||||::.||||
Zfish    64 ELDDRADALQAGASQFESCAAKLKNKYWWKNCKMMIIMGVIGVLFVGII 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 62/80 (78%)
R-SNARE_VAMP2 40..102 CDD:277223 49/61 (80%)
vamp1bNP_001002532.1 Synaptobrevin 30..117 CDD:279324 64/83 (77%)
R-SNARE_VAMP2 32..94 CDD:277223 49/61 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589083
Domainoid 1 1.000 128 1.000 Domainoid score I5254
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4391
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - otm26350
orthoMCL 1 0.900 - - OOG6_103752
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X424
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.