DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and vamp3

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001002073.1 Gene:vamp3 / 415163 ZFINID:ZDB-GENE-040625-45 Length:102 Species:Danio rerio


Alignment Length:117 Identity:63/117 - (53%)
Similarity:77/117 - (65%) Gaps:22/117 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDS 68
            :||..||..::|                      :.:|||||||||||||||||.||:||||||.
Zfish     2 SAPGADASGSSG----------------------SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ 44

  Fly    69 KLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII 120
            |||||||||||||.||||||..|.|||||||.:|:||..|:..:.::::.||
Zfish    45 KLSELDDRADALQAGASQFETSAAKLKRKFWWKNVKMWAILIAVVVIIIIII 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 56/80 (70%)
R-SNARE_VAMP2 40..102 CDD:277223 52/61 (85%)
vamp3NP_001002073.1 Synaptobrevin 14..>82 CDD:279324 54/67 (81%)
R-SNARE_VAMP2 16..78 CDD:277223 52/61 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5254
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103752
Panther 1 1.100 - - LDO PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 1 1.000 - - X424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.