DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and vamp1a

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_998563.1 Gene:vamp1a / 406707 ZFINID:ZDB-GENE-040426-2725 Length:119 Species:Danio rerio


Alignment Length:117 Identity:75/117 - (64%)
Similarity:89/117 - (76%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAPAGDAPPNA-GAPAGEGGDGEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERD 67
            :||...|.|.| |||.|||      |.|..|..:.:.:|||||||||||||||||.||:||||||
Zfish     2 SAPDAAASPGAPGAPEGEG------GAPAQPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERD 60

  Fly    68 SKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGI 119
            .|||||||||||||.||||||..|.|||.|:|.:|:|||||||::|::::||
Zfish    61 QKLSELDDRADALQAGASQFESSAAKLKNKYWWKNMKMMIIMGIMGIILLGI 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 61/81 (75%)
R-SNARE_VAMP2 40..102 CDD:277223 50/61 (82%)
vamp1aNP_998563.1 Synaptobrevin 31..>97 CDD:279324 51/65 (78%)
R-SNARE_VAMP2 33..95 CDD:277223 50/61 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589082
Domainoid 1 1.000 128 1.000 Domainoid score I5254
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4391
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - otm26350
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.